PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 405aa    MW: 45668.2 Da    PI: 5.2813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.74e-52321591128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yL++k+ +k++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v 
  XP_016432498.1  32 LAPGFRFHPTDEELVRYYLRRKACSKPFRF-QAVSEIDVYKSEPWELAEysSLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVR 125
                     579*************************99.88**************84346777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + k++++g+kktLvf++grap+g++t+Wvmheyrl
  XP_016432498.1 126 H-KSQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 159
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-6225182IPR003441NAC domain
PROSITE profilePS5100558.03632182IPR003441NAC domain
PfamPF023653.9E-2834159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEQEGALVIV PAAVPVTTAT PKRAVAPPPT SLAPGFRFHP TDEELVRYYL RRKACSKPFR  60
FQAVSEIDVY KSEPWELAEY SSLKTRDLEW YFFSPVDRKY GNGSRLNRAT GKGYWKATGK  120
DRPVRHKSQT IGMKKTLVFH SGRAPDGKRT NWVMHEYRLT DEELERAGVV QDAFVLCRIF  180
QKSGLGPPNG DRYAPFIEEE WDDDTALLVP GGETEDDAAN GDEARVEGND LDQDARHKAP  240
PRQSENLLDP QPIPFICKRE RSPEDPEPLS LAQSKRSKRE DPSSSHANGS EDSTTSQQDP  300
PTTMMTTNYS PPSLLAFPLL EPLEPKESQP SNPPTFDSSN LEKSVPPGYL KFISNLENEI  360
LNVSMERETL KIEVMRAQAM INILQSRIDL LNKENEDLRR LVRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-513118216165NO APICAL MERISTEM PROTEIN
1ut4_B5e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_A5e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_B5e-513118216165NO APICAL MERISTEM PROTEIN
4dul_A5e-513118216165NAC domain-containing protein 19
4dul_B5e-513118216165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5098670.0AF509867.1 Petunia x hybrida nam-like protein 4 (NH4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432498.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLQ8LRM10.0Q8LRM1_PETHY; Nam-like protein 4
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.15e-96NAC domain containing protein 52